PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G07680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 700aa    MW: 77698.8 Da    PI: 5.6539
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G07680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.49.8e-22123223198
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+ltpsd++++g +++ +++a+e+        + ++  ++l+ +d++g +W++k+iyr++++r++lt+GW+ Fv +++L +gD +v    ++
  LPERR01G07680.1 123 FCKILTPSDTSTHGGFSVLRRHANEClppldmsLLTPT--QELITKDLHGSEWRFKHIYRGQPRRHLLTTGWSTFVTSKKLISGDAFVYL--RS 212
                      99***************************998544443..48999******************************************999..44 PP

                      SEE..EEEEE- CS
               B3  88 sefelvvkvfr 98 
                      +++e +v+v+r
  LPERR01G07680.1 213 ETGEQRVGVRR 223
                      77778999997 PP

2Auxin_resp98.21.1e-32249330183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t+s+F v+Y+Pr s+s+++v+v+k+++a k+ + vGmRfkm+fe+ed++ +++sGt+vg  dl+p +W++S+W+sLk
  LPERR01G07680.1 249 ASHAIKTNSIFLVYYRPRLSQSQYIVSVNKYLAASKIGFNVGMRFKMSFEGEDVPVKKFSGTIVGDDDLSP-QWSGSEWKSLK 330
                      789********************************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-37114252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-35115238IPR015300DNA-binding pseudobarrel domain
CDDcd100172.64E-16121223No hitNo description
SMARTSM010191.2E-16123225IPR003340B3 DNA binding domain
PfamPF023622.3E-19123223IPR003340B3 DNA binding domain
PROSITE profilePS5086311.068123225IPR003340B3 DNA binding domain
PfamPF065079.1E-29249330IPR010525Auxin response factor
PfamPF023095.6E-7586632IPR033389AUX/IAA domain
SuperFamilySSF542771.67E-9592669No hitNo description
PROSITE profilePS5174524.846596685IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-4597661No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MAQGGGGGGG VGDPELVAEL WRACAGPLVE VPQRDERVFY FLQGHLEQLQ EPTDPALLAE  60
QIKMFQVPYK ILCKVVNVEL KAETETDEVF AQITLQPDPD QENLPTLPDP PLPEQPRPVV  120
HSFCKILTPS DTSTHGGFSV LRRHANECLP PLDMSLLTPT QELITKDLHG SEWRFKHIYR  180
GQPRRHLLTT GWSTFVTSKK LISGDAFVYL RSETGEQRVG VRRLVQKQST MPASVISSQS  240
MHLGVLASAS HAIKTNSIFL VYYRPRLSQS QYIVSVNKYL AASKIGFNVG MRFKMSFEGE  300
DVPVKKFSGT IVGDDDLSPQ WSGSEWKSLK VQWDEVTSVN GPERVSPWEI ETCDATAPAI  360
TVPLQSSVKN KRPREPSETL DLQSLEPAQE FWLSGMPQQH EKTGIGSSEP NCISGHQVVW  420
PGEHLGYGAV SSSSVCQNPL VLESWLKDFN SSSKGVSPTL SEISQKLFQV TSNEARLATW  480
PARSAYQAEE PTSKLSTNTA LSGYRTEEVA PNASKVVEGK KEHGMFRLFG VDLMKCTSIS  540
ATTDKASVGT EETSAKAAGS NEDSSQLSAF SKVTKDHIVV DESPREIQSH QNYAKKNRIK  600
VQMQGNAVGR AVDLANIDGY EQLMNELEEM FNIKDLKQKW KVAFTDDEGD TMKVGDDPWL  660
EFCQMVRKIV LYPIEDEKKI DPHPKSLPSA NPEQDHKTEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-15233606362Auxin response factor 1
4ldw_A1e-15233606362Auxin response factor 1
4ldw_B1e-15233606362Auxin response factor 1
4ldx_A1e-15233606362Auxin response factor 1
4ldx_B1e-15233606362Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0713000.0AB071300.1 Oryza sativa OsARF16 mRNA for auxin response factor 16, partial cds.
GenBankAK1025210.0AK102521.1 Oryza sativa Japonica Group cDNA clone:J033095P08, full insert sequence.
GenBankEU8470080.0EU847008.1 Oryza sativa Japonica Group clone KCS385B05 auxin response factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622434.10.0PREDICTED: auxin response factor 1 isoform X1
SwissprotQ5NB850.0ARFA_ORYSJ; Auxin response factor 1
TrEMBLA0A0D9UYK40.0A0A0D9UYK4_9ORYZ; Auxin response factor
STRINGLOC_Os01g13520.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1